TTL (NM_153712) Human Mass Spec Standard

CAT#: PH307805

TTL MS Standard C13 and N15-labeled recombinant protein (NP_714923)

Product Images

Coomassie blue staining of purified TTL protein (Cat# TP307805). The protein was produced from HEK293T cells transfected with TTL cDNA clone (Cat# RC207805) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207805
• Predicted MW: 43.2 kDa
• Protein Sequence:
  Sequence Link

  >RC207805 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MYTFVVRDENSSVYAEVSRLLLATGHWKRLRRDNPRFNLMLGERNRLPFGRLGHEPGLVQLVNYYRGADK
  LCRKASLVKLIKTSPELAESCTWFPESYVIYPTNLKTPVAPAQNGIQPPISNSRTDEREFFLASYNRKKE
  DGEGNVWIAKSSAGAKGEGILISSEASELLDFIDNQGQVHVIQKYLEHPLLLEPGHRKFDIRSWVLVDHQ
  YNIYLYREGVLRTASEPYHVDNFQDKTCHLTNHCIQKEYSKNYGKYEEGNEMFFKEFNQYLTSALNITLE
  SSILLQIKHIIRNCLLSVEPAISTKHLPYQSFQLFGFDFMVDEELKVWLIEVNGAPACAQKLYAELCQGI
  VDIAISSVFPPPDVEQPQTQPAAFIKL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_714923
• RefSeq Size: 5181
• RefSeq ORF: 1131
• Synonyms: MGC46235
• Locus ID: 150465
• UniProt ID: Q8NG68
• Cytogenetics: 2q14.1
• Summary: TTL is a cytosolic enzyme involved in the posttranslational modification of alpha-tubulin (see MIM 602529). Alpha-tubulin within assembled microtubules is detyrosinated over time at the C terminus. After microtubule disassembly, TTL restores the tyrosine residues and consequently participates in a cycle of tubulin detyrosination and tyrosination (Erck et al., 2003 [PubMed 14571137]). [supplied by OMIM, Mar 2008]