Germany
Japan
United Kingdom
China
TTL (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 355-385 amino acids from the C-terminal region of human TTL |
Antibodies
View as table Download
Rabbit Polyclonal Anti-TTL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TTL antibody: synthetic peptide directed towards the middle region of human TTL. Synthetic peptide located within the following region: LYREGVLRTASEPYHVDNFQDKTCHLTNHCIQKEYSKNYGKYEEGNEMFF |
Carrier-free (BSA/glycerol-free) TTL mouse monoclonal antibody, clone OTI3G5 (formerly 3G5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TTL Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human TTL (NP_714923.1). |
| Modifications | Unmodified |
TTL mouse monoclonal antibody, clone OTI3G5 (formerly 3G5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TTL mouse monoclonal antibody, clone OTI3G5 (formerly 3G5), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
TTL mouse monoclonal antibody, clone OTI3G5 (formerly 3G5), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
TTL mouse monoclonal antibody, clone OTI3G5 (formerly 3G5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- TTL