SDF1 (CXCL12) (NM_199168) Human Mass Spec Standard

CAT#: PH307891

CXCL12 MS Standard C13 and N15-labeled recombinant protein (NP_954637)

Product Images

Coomassie blue staining of purified CXCL12 protein (Cat# TP307891). The protein was produced from HEK293T cells transfected with CXCL12 cDNA clone (Cat# RC207891) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207891
• Predicted MW: 9.9 kDa
• Protein Sequence:
  Sequence Link

  >RC207891 representing NM_199168
  Red=Cloning site Green=Tags(s)
  
  MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQV
  CIDPKLKWIQEYLEKALNK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_954637
• RefSeq Size: 1937
• RefSeq ORF: 267
• Synonyms: IRH; PBSF; SCYB12; SDF1; TLSF; TPAR1
• Locus ID: 6387
• UniProt ID: P48061
• Cytogenetics: 10q11.21
• Summary: 'This antimicrobial gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]'
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
• Protein Pathways: Axon guidance, Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Leukocyte transendothelial migration