SDF1 (CXCL12) (NM_199168) Human Mass Spec Standard
CAT#: PH307891
CXCL12 MS Standard C13 and N15-labeled recombinant protein (NP_954637)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207891 |
Predicted MW | 9.9 kDa |
Protein Sequence |
>RC207891 representing NM_199168
Red=Cloning site Green=Tags(s) MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQV CIDPKLKWIQEYLEKALNK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_954637 |
RefSeq Size | 1937 |
RefSeq ORF | 267 |
Synonyms | IRH; PBSF; SCYB12; SDF1; TLSF; TPAR1 |
Locus ID | 6387 |
UniProt ID | P48061 |
Cytogenetics | 10q11.21 |
Summary | 'This antimicrobial gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]' |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
Protein Pathways | Axon guidance, Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Leukocyte transendothelial migration |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424610 | CXCL12 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY424610 | Transient overexpression lysate of chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2 |
USD 325.00 |
|
TP307891 | Purified recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 1, with C-terminal MYC/DDK tag, secretory expressed in HEK293 cells, 20ug |
USD 823.00 |
|
TP720102 | Recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2 |
USD 300.00 |
|
TP720103 | Recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2 |
USD 300.00 |
|
TP723402 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 12 (CXCL12), transcript variant 2. |
USD 240.00 |
|
TP723405 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 12 (CXCL12), transcript variant 2. |
USD 240.00 |
|
TP723784 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 12 (CXCL12 / SDF-1alpha), transcript variant 1 |
USD 255.00 |
|
TP723843 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 12 (CXCL12 / SDF-1beta), transcript variant 2 |
USD 255.00 |
|
TP750013 | Recombinant protein of human stromal cell-derived factor-1 (SDF-1) produced in E. coli. |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review