SDF1 (CXCL12) (NM_000609) Human Recombinant Protein

CAT#: TP723405

Purified recombinant protein of Human chemokine (C-X-C motif) ligand 12 (CXCL12), transcript variant 2.


  View other "CXCL12" proteins (10)

USD 240.00

5 Days*

Size
    • 10 ug

Product Images

Other products for "CXCL12"

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Tag Tag Free
Predicted MW 8.5 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Bioactivity Determined by its ability to chemoattract human peripheral T cells activated with PHA and IL-2 using a concentration range of 20-80 ng/ml.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_000600
Locus ID 6387
UniProt ID P48061
Cytogenetics 10q11.21
Refseq Size 3560
Refseq ORF 279
Synonyms IRH; PBSF; SCYB12; SDF1; TLSF; TPAR1
Summary 'This antimicrobial gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]'
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein
Protein Pathways Axon guidance, Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Leukocyte transendothelial migration

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.