SDF1 (CXCL12) (NM_000609) Human Recombinant Protein
CAT#: TP723405
Purified recombinant protein of Human chemokine (C-X-C motif) ligand 12 (CXCL12), transcript variant 2.
Product Images
Specifications
| Product Data | |
| Species | Human |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
|
| Tag | Tag Free |
| Predicted MW | 8.5 kDa |
| Concentration | Resuspend the protein in the desired concentration in proper buffer |
| Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Bioactivity | Determined by its ability to chemoattract human peripheral T cells activated with PHA and IL-2 using a concentration range of 20-80 ng/ml. |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Storage | Store at -80°C. |
| Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_000600 |
| Locus ID | 6387 |
| UniProt ID | P48061 |
| Cytogenetics | 10q11.21 |
| Refseq Size | 3560 |
| Refseq ORF | 279 |
| Synonyms | IRH; PBSF; SCYB12; SDF1; TLSF; TPAR1 |
| Summary | 'This antimicrobial gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]' |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
| Protein Pathways | Axon guidance, Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Leukocyte transendothelial migration |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424610 | CXCL12 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY424610 | Transient overexpression lysate of chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2 |
USD 436.00 |
|
| PH307891 | CXCL12 MS Standard C13 and N15-labeled recombinant protein (NP_954637) |
USD 2,055.00 |
|
| TP307891 | Purified recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 1, with C-terminal MYC/DDK tag, secretory expressed in HEK293 cells, 20ug |
USD 823.00 |
|
| TP720102 | Recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2 |
USD 330.00 |
|
| TP720103 | Recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2 |
USD 330.00 |
|
| TP723402 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 12 (CXCL12), transcript variant 2. |
USD 240.00 |
|
| TP723784 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 12 (CXCL12 / SDF-1alpha), transcript variant 1 |
USD 255.00 |
|
| TP723843 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 12 (CXCL12 / SDF-1beta), transcript variant 2 |
USD 255.00 |
|
| TP750013 | Recombinant protein of human stromal cell-derived factor-1 (SDF-1) produced in E. coli. |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China