Radixin (RDX) (NM_002906) Human Mass Spec Standard

CAT#: PH307953

RDX MS Standard C13 and N15-labeled recombinant protein (NP_002897)

Product Images

Coomassie blue staining of purified RDX protein (Cat# TP307953). The protein was produced from HEK293T cells transfected with RDX cDNA clone (Cat# RC207953) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC207953
• Predicted MW: 68.4 kDa
• Protein Sequence:
  Sequence Link

  >RC207953 representing NM_002906
  Red=Cloning site Green=Tags(s)
  
  MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDV
  KKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKE
  IHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKN
  KKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI
  LALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERAQLENEKEKREIAEKEKERIEREKEELMER
  LKQIEEQTIKAQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAE
  LAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIPPTENEHDEHD
  ENNAEASAELSNEGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARDETKKTQNDVLHAENVKAGRD
  KYKTLRQIRQGNTKQRIDEFEAM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002897
• RefSeq Size: 4498
• RefSeq ORF: 1749
• Synonyms: DFNB24
• Locus ID: 5962
• UniProt ID: P35241, B0YJ88, Q6PKD3
• Cytogenetics: 11q22.3
• Summary: 'Radixin is a cytoskeletal protein that may be important in linking actin to the plasma membrane. It is highly similar in sequence to both ezrin and moesin. The radixin gene has been localized by fluorescence in situ hybridization to 11q23. A truncated version representing a pseudogene (RDXP2) was assigned to Xp21.3. Another pseudogene that seemed to lack introns (RDXP1) was mapped to 11p by Southern and PCR analyses. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2012]'
• Protein Families: Druggable Genome
• Protein Pathways: Regulation of actin cytoskeleton