Radixin (RDX) (NM_002906) Human Recombinant Protein

CAT#: TP307953

Recombinant protein of human radixin (RDX)

Product Images

Coomassie blue staining of purified RDX protein (Cat# TP307953). The protein was produced from HEK293T cells transfected with RDX cDNA clone (Cat# RC207953) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207953 representing NM_002906
  Red=Cloning site Green=Tags(s)
  
  MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDV
  KKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKE
  IHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKN
  KKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRI
  LALCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERAQLENEKEKREIAEKEKERIEREKEELMER
  LKQIEEQTIKAQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAE
  LAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIPPTENEHDEHD
  ENNAEASAELSNEGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARDETKKTQNDVLHAENVKAGRD
  KYKTLRQIRQGNTKQRIDEFEAM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 68.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002897
• Locus ID: 5962
• UniProt ID: P35241, B0YJ88, Q6PKD3
• Cytogenetics: 11q22.3
• Refseq Size: 4498
• Refseq ORF: 1749
• Synonyms: DFNB24
• Summary: Radixin is a cytoskeletal protein that may be important in linking actin to the plasma membrane. It is highly similar in sequence to both ezrin and moesin. The radixin gene has been localized by fluorescence in situ hybridization to 11q23. A truncated version representing a pseudogene (RDXP2) was assigned to Xp21.3. Another pseudogene that seemed to lack introns (RDXP1) was mapped to 11p by Southern and PCR analyses. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2012]
• Protein Families: Druggable Genome
• Protein Pathways: Regulation of actin cytoskeleton