TBXAS1 (NM_001061) Human Mass Spec Standard
CAT#: PH308028
TBXAS1 MS Standard C13 and N15-labeled recombinant protein (NP_001052)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208028 |
| Predicted MW | 60.6 kDa |
| Protein Sequence |
>RC208028 protein sequence
Red=Cloning site Green=Tags(s) MMEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFRQGFWESQME LRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSVLFLRDKRWEEVRGAL MSAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPF VKHCKRFFEFCIPRPILVLLLSFPSIMVPLARILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFL QMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNT LSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCE VLGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEV KLTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001052 |
| RefSeq Size | 2082 |
| RefSeq ORF | 1602 |
| Synonyms | BDPLT14; CYP5; CYP5A1; GHOSAL; THAS; TS; TXAS; TXS |
| Locus ID | 6916 |
| UniProt ID | P24557, Q53F23 |
| Cytogenetics | 7q34 |
| Summary | 'This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to thromboxane A2, a potent vasoconstrictor and inducer of platelet aggregation. The enzyme plays a role in several pathophysiological processes including hemostasis, cardiovascular disease, and stroke. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]' |
| Protein Families | Druggable Genome, P450 |
| Protein Pathways | Arachidonic acid metabolism, Metabolic pathways |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420741 | TBXAS1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC427328 | TBXAS1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY420741 | Transient overexpression lysate of thromboxane A synthase 1 (platelet) (TBXAS1), transcript variant 1 |
USD 436.00 |
|
| LY427328 | Transient overexpression lysate of thromboxane A synthase 1 (platelet) (TBXAS1), transcript variant 3 |
USD 436.00 |
|
| PH325917 | TBXAS1 MS Standard C13 and N15-labeled recombinant protein (NP_001124438) |
USD 2,055.00 |
|
| TP308028 | Recombinant protein of human thromboxane A synthase 1 (platelet) (TBXAS1), transcript variant TXS-I |
USD 823.00 |
|
| TP325917 | Recombinant protein of human thromboxane A synthase 1 (platelet) (TBXAS1), transcript variant TXS-III |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China