NDUFAF4 (NM_014165) Human Mass Spec Standard

CAT#: PH308120

NDUFAF4 MS Standard C13 and N15-labeled recombinant protein (NP_054884)

Product Images

Coomassie blue staining of purified NDUFAF4 protein (Cat# TP308120). The protein was produced from HEK293T cells transfected with NDUFAF4 cDNA clone (Cat# RC208120) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208120
• Predicted MW: 20.3 kDa
• Protein Sequence:
  Sequence Link

  >RC208120 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGALVIRGIRNFNLENRAEREISKMKPSVAPRHPSTNSLLREQISLYPEVKGEIARKDEKLLSFLKDVYV
  DSKDPVSSLQVKAAETCQEPKEFRLPKDHHFDMINIKSIPKGKISIVEALTLLNNHKLFPETWTAEKIMQ
  EYQLEQKDVNSLLKYFVTFEVEIFPPEDKKAIRSK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_054884
• RefSeq Size: 2411
• RefSeq ORF: 525
• Synonyms: bA22L21.1; C6orf66; HRPAP20; HSPC125; MC1DN15; My013
• Locus ID: 29078
• UniProt ID: Q9P032
• Cytogenetics: 6q16.1
• Summary: NADH:ubiquinone oxidoreductase (complex I) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. This gene encodes a complex I assembly factor. Mutations in this gene are a cause of mitochondrial complex I deficiency. [provided by RefSeq, Oct 2009]