NDUFAF4 (NM_014165) Human Recombinant Protein

CAT#: TP308120

Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 4 (NDUFAF4)

Product Images

Coomassie blue staining of purified NDUFAF4 protein (Cat# TP308120). The protein was produced from HEK293T cells transfected with NDUFAF4 cDNA clone (Cat# RC208120) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208120 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGALVIRGIRNFNLENRAEREISKMKPSVAPRHPSTNSLLREQISLYPEVKGEIARKDEKLLSFLKDVYV
  DSKDPVSSLQVKAAETCQEPKEFRLPKDHHFDMINIKSIPKGKISIVEALTLLNNHKLFPETWTAEKIMQ
  EYQLEQKDVNSLLKYFVTFEVEIFPPEDKKAIRSK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_054884
• Locus ID: 29078
• UniProt ID: Q9P032
• Cytogenetics: 6q16.1
• Refseq Size: 2411
• Refseq ORF: 525
• Synonyms: bA22L21.1; C6orf66; HRPAP20; HSPC125; MC1DN15; My013
• Summary: NADH:ubiquinone oxidoreductase (complex I) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. This gene encodes a complex I assembly factor. Mutations in this gene are a cause of mitochondrial complex I deficiency. [provided by RefSeq, Oct 2009]