Kallikrein 8 (KLK8) (NM_007196) Human Mass Spec Standard
CAT#: PH308152
KLK8 MS Standard C13 and N15-labeled recombinant protein (NP_009127)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208152 |
| Predicted MW | 28.1 kDa |
| Protein Sequence |
>RC208152 protein sequence
Red=Cloning site Green=Tags(s) MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLT AAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPIS LADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDVMVCAGSSKGADTCQG DSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_009127 |
| RefSeq Size | 1023 |
| RefSeq ORF | 780 |
| Synonyms | HNP; NP; NRPN; PRSS19; TADG14 |
| Locus ID | 11202 |
| UniProt ID | O60259 |
| Cytogenetics | 19q13.41 |
| Summary | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in tandem in a gene cluster on chromosome 19. The encoded protein may be involved in proteolytic cascade in the skin and may serve as a biomarker for ovarian cancer. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408269 | KLK8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC416130 | KLK8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC430111 | KLK8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY408269 | Transient overexpression lysate of kallikrein-related peptidase 8 (KLK8), transcript variant 2 |
USD 436.00 |
|
| LY416130 | Transient overexpression lysate of kallikrein-related peptidase 8 (KLK8), transcript variant 1 |
USD 436.00 |
|
| LY430111 | Transient overexpression lysate of kallikrein-related peptidase 8 (KLK8), transcript variant 2 |
USD 396.00 |
|
| TP308152 | Recombinant protein of human kallikrein-related peptidase 8 (KLK8), transcript variant 1 |
USD 439.00 |
|
| TP710038 | Recombinant protein of human kallikrein-related peptidase 8 (KLK8), transcript variant 1, residues 33-260aa, with C-terminal DDK tag, expressed in sf9 cells. |
USD 425.00 |
|
| TP720648 | Purified recombinant protein of Human kallikrein-related peptidase 8 (KLK8), transcript variant 1 |
USD 330.00 |
|
| TP761586 | Purified recombinant protein of Human kallikrein-related peptidase 8 (KLK8), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China