Kallikrein 8 (KLK8) (NM_007196) Human Recombinant Protein
CAT#: TP720648
Purified recombinant protein of Human kallikrein-related peptidase 8 (KLK8), transcript variant 1
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
QEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDVMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKGVDHHHHHH
|
Tag | C-His |
Predicted MW | 26.04 kDa |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Supplied as a 0.2 µM filtered solution of 20mM Tris-HCl, 150mM NaCl, pH 8.0 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 3 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_009127 |
Locus ID | 11202 |
UniProt ID | O60259 |
Cytogenetics | 19q13.41 |
Refseq Size | 1023 |
Refseq ORF | 780 |
Synonyms | HNP; NP; NRPN; PRSS19; TADG14 |
Summary | Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in tandem in a gene cluster on chromosome 19. The encoded protein may be involved in proteolytic cascade in the skin and may serve as a biomarker for ovarian cancer. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408269 | KLK8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC416130 | KLK8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430111 | KLK8 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY408269 | Transient overexpression lysate of kallikrein-related peptidase 8 (KLK8), transcript variant 2 |
USD 325.00 |
|
LY416130 | Transient overexpression lysate of kallikrein-related peptidase 8 (KLK8), transcript variant 1 |
USD 325.00 |
|
LY430111 | Transient overexpression lysate of kallikrein-related peptidase 8 (KLK8), transcript variant 2 |
USD 325.00 |
|
PH308152 | KLK8 MS Standard C13 and N15-labeled recombinant protein (NP_009127) |
USD 2,055.00 |
|
TP308152 | Recombinant protein of human kallikrein-related peptidase 8 (KLK8), transcript variant 1 |
USD 439.00 |
|
TP710038 | Recombinant protein of human kallikrein-related peptidase 8 (KLK8), transcript variant 1, residues 33-260aa, with C-terminal DDK tag, expressed in sf9 cells. |
USD 425.00 |
|
TP761586 | Purified recombinant protein of Human kallikrein-related peptidase 8 (KLK8), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review