SPACA4 (NM_133498) Human Mass Spec Standard

CAT#: PH308285

SPACA4 MS Standard C13 and N15-labeled recombinant protein (NP_598005)

Product Images

Coomassie blue staining of purified SPACA4 protein (Cat# TP308285). The protein was produced from HEK293T cells transfected with SPACA4 cDNA clone (Cat# RC208285) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208285
• Predicted MW: 13 kDa
• Protein Sequence:
  Sequence Link

  >RC208285 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVLCWLLLLVMALPPGTTGVKDCVFCELTDSMQCPGTYMHCGDDEDCFTGHGVAPGTGPVINKGCLRATS
  CGLEEPVSYRGVTYSLTTNCCTGRLCNRAPSSQTVGATTSLALGLGMLLPPRLL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_598005
• RefSeq Size: 978
• RefSeq ORF: 372
• Synonyms: SAMP14
• Locus ID: 171169
• UniProt ID: Q8TDM5, A0A140VJU1
• Cytogenetics: 19q13.33
• Summary: Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. [UniProtKB/Swiss-Prot Function]