SPACA4 (NM_133498) Human Recombinant Protein

CAT#: TP308285

Recombinant protein of human sperm acrosome associated 4 (SPACA4)

Product Images

Coomassie blue staining of purified SPACA4 protein (Cat# TP308285). The protein was produced from HEK293T cells transfected with SPACA4 cDNA clone (Cat# RC208285) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208285 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVLCWLLLLVMALPPGTTGVKDCVFCELTDSMQCPGTYMHCGDDEDCFTGHGVAPGTGPVINKGCLRATS
  CGLEEPVSYRGVTYSLTTNCCTGRLCNRAPSSQTVGATTSLALGLGMLLPPRLL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_598005
• Locus ID: 171169
• UniProt ID: Q8TDM5, A0A140VJU1
• Cytogenetics: 19q13.33
• Refseq Size: 978
• Refseq ORF: 372
• Synonyms: SAMP14
• Summary: Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization.[UniProtKB/Swiss-Prot Function]