Cathepsin Z (CTSZ) (NM_001336) Human Mass Spec Standard

CAT#: PH308341

CTSZ MS Standard C13 and N15-labeled recombinant protein (NP_001327)

Product Images

Coomassie blue staining of purified CTSZ protein (Cat# TP308341). The protein was produced from HEK293T cells transfected with CTSZ cDNA clone (Cat# RC208341) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208341
• Predicted MW: 33.9 kDa
• Protein Sequence:
  Sequence Link

  >RC208341 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRN
  VDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSV
  WDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANG
  PISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTY
  KDGKGARYNLAIEEHCTFGDPIV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001327
• RefSeq Size: 1517
• RefSeq ORF: 909
• Synonyms: CTSX
• Locus ID: 1522
• UniProt ID: Q9UBR2
• Cytogenetics: 20q13.32
• Summary: 'The protein encoded by this gene is a lysosomal cysteine proteinase and member of the peptidase C1 family. It exhibits both carboxy-monopeptidase and carboxy-dipeptidase activities. The encoded protein has also been known as cathepsin X and cathepsin P. This gene is expressed ubiquitously in cancer cell lines and primary tumors and, like other members of this family, may be involved in tumorigenesis. [provided by RefSeq, Oct 2008]'
• Protein Families: Druggable Genome, Protease
• Protein Pathways: Lysosome