Cathepsin Z (CTSZ) (NM_001336) Human Recombinant Protein

CAT#: TP308341

Recombinant protein of human cathepsin Z (CTSZ)

Product Images

Coomassie blue staining of purified CTSZ protein (Cat# TP308341). The protein was produced from HEK293T cells transfected with CTSZ cDNA clone (Cat# RC208341) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208341 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARRGPGWRPLLLLVLLAGAAQGGLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRN
  VDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSV
  WDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANG
  PISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTY
  KDGKGARYNLAIEEHCTFGDPIV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001327
• Locus ID: 1522
• UniProt ID: Q9UBR2
• Cytogenetics: 20q13.32
• Refseq Size: 1517
• Refseq ORF: 909
• Synonyms: CTSX
• Summary: The protein encoded by this gene is a lysosomal cysteine proteinase and member of the peptidase C1 family. It exhibits both carboxy-monopeptidase and carboxy-dipeptidase activities. The encoded protein has also been known as cathepsin X and cathepsin P. This gene is expressed ubiquitously in cancer cell lines and primary tumors and, like other members of this family, may be involved in tumorigenesis. [provided by RefSeq, Oct 2008]
• Protein Families: Druggable Genome, Protease
• Protein Pathways: Lysosome