HE4 (WFDC2) (NM_006103) Human Mass Spec Standard

CAT#: PH308491

WFDC2 MS Standard C13 and N15-labeled recombinant protein (NP_006094)

Product Images

Coomassie blue staining of purified WFDC2 protein (Cat# TP308491). The protein was produced from HEK293T cells transfected with WFDC2 cDNA clone (Cat# RC208491) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208491
• Predicted MW: 13 kDa
• Protein Sequence:
  Sequence Link

  >RC208491 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFC
  SLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006094
• RefSeq Size: 570
• RefSeq ORF: 372
• Synonyms: dJ461P17.6; EDDM4; HE4; WAP5
• Locus ID: 10406
• UniProt ID: Q14508, A0A384MTN6
• Cytogenetics: 20q13.12
• Summary: This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein, Transmembrane