HE4 (WFDC2) (NM_006103) Human Recombinant Protein

CAT#: TP308491

Recombinant protein of human WAP four-disulfide core domain 2 (WFDC2)


  View other "WFDC2" proteins (5)

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

USD 823.00

5 Days*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


WFDC2 (HE4) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)
    • 100 ul

USD 379.00

Other products for "WFDC2"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC208491 protein sequence
Red=Cloning site Green=Tags(s)

MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFC
SLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 10 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_006094
Locus ID 10406
UniProt ID Q14508, A0A384MTN6
Cytogenetics 20q13.12
Refseq Size 570
Refseq ORF 372
Synonyms dJ461P17.6; EDDM4; HE4; WAP5
Summary This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation. [provided by RefSeq, Jul 2008]
Protein Families Secreted Protein, Transmembrane

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.