HE4 (WFDC2) (NM_006103) Human Recombinant Protein
CAT#: TP308491
Recombinant protein of human WAP four-disulfide core domain 2 (WFDC2)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208491 protein sequence
Red=Cloning site Green=Tags(s) MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFC SLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006094 |
Locus ID | 10406 |
UniProt ID | Q14508, A0A384MTN6 |
Cytogenetics | 20q13.12 |
Refseq Size | 570 |
Refseq ORF | 372 |
Synonyms | dJ461P17.6; EDDM4; HE4; WAP5 |
Summary | This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416866 | WFDC2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY416866 | Transient overexpression lysate of WAP four-disulfide core domain 2 (WFDC2) |
USD 396.00 |
|
PH308491 | WFDC2 MS Standard C13 and N15-labeled recombinant protein (NP_006094) |
USD 2,055.00 |
|
TP720455 | Recombinant protein of human WAP four-disulfide core domain 2 (WFDC2) |
USD 330.00 |
|
TP750124 | Purified recombinant protein of Human WAP four-disulfide core domain 2 (HE4), N-terminal Trx-HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review