HE4 (WFDC2) (NM_006103) Human Recombinant Protein

CAT#: TP308491

Recombinant protein of human WAP four-disulfide core domain 2 (WFDC2)

Product Images

Coomassie blue staining of purified WFDC2 protein (Cat# TP308491). The protein was produced from HEK293T cells transfected with WFDC2 cDNA clone (Cat# RC208491) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208491 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFC
  SLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006094
• Locus ID: 10406
• UniProt ID: Q14508, A0A384MTN6
• Cytogenetics: 20q13.12
• Refseq Size: 570
• Refseq ORF: 372
• Synonyms: dJ461P17.6; EDDM4; HE4; WAP5
• Summary: This gene encodes a protein that is a member of the WFDC domain family. The WFDC domain, or WAP Signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. This gene is expressed in pulmonary epithelial cells, and was also found to be expressed in some ovarian cancers. The encoded protein is a small secretory protein, which may be involved in sperm maturation. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein, Transmembrane