Mitocondrial Translational Initiation Factor 3 (MTIF3) (NM_152912) Human Mass Spec Standard
CAT#: PH308533
MTIF3 MS Standard C13 and N15-labeled recombinant protein (NP_690876)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208533 |
| Predicted MW | 31.7 kDa |
| Protein Sequence |
>RC208533 protein sequence
Red=Cloning site Green=Tags(s) MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKIKK NKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQER QRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIF HQILQTMPGIATFSSRPQAVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_690876 |
| RefSeq Size | 1037 |
| RefSeq ORF | 834 |
| Synonyms | IF3mt |
| Locus ID | 219402 |
| UniProt ID | Q9H2K0 |
| Cytogenetics | 13q12.2 |
| Summary | This gene encodes a translation initiation factor that is involved in mitochondrial protein synthesis. Polymorphism in this gene is associated with the onset of Parkinson's disease. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 5. [provided by RefSeq, Oct 2009] |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407210 | MTIF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC432812 | MTIF3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY407210 | Transient overexpression lysate of mitochondrial translational initiation factor 3 (MTIF3), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 436.00 |
|
| LY432812 | Transient overexpression lysate of mitochondrial translational initiation factor 3 (MTIF3), nuclear gene encoding mitochondrial protein, transcript variant 4 |
USD 436.00 |
|
| TP308533 | Recombinant protein of human mitochondrial translational initiation factor 3 (MTIF3), nuclear gene encoding mitochondrial protein |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China