TRP1 (TYRP1) (NM_000550) Human Mass Spec Standard

CAT#: PH308595

TYRP1 MS Standard C13 and N15-labeled recombinant protein (NP_000541)

Product Images

Coomassie blue staining of purified TYRP1 protein (Cat# TP308595). The protein was produced from HEK293T cells transfected with TYRP1 cDNA clone (Cat# RC208595) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208595
• Predicted MW: 60.7 kDa
• Protein Sequence:
  Sequence Link

  >RC208595 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSAPKLLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTA
  DSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEE
  KNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGE
  VDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGKNVCDICTDDLMGSRSNFDSTLISPN
  SVFSQWRVVCDSLEDYDTLGTLCNSTEDGPIRRNPAGNVARPMVQRLPEPQDVAQCLEVGLFDTPPFYSN
  STNSFRNTVEGYSDPTGKYDPAVRSLHNLAHLFLNGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNA
  DISTFPLENAPIGHNRQYNMVPFWPPVTNTEMFVTAPDNLGYTYEIQWPSREFSVPEIIAIAVVGALLLV
  ALIFGTASYLIRARRSMDEANQPLLTDQYQCYAEEYEKLQNPNQSVV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000541
• RefSeq Size: 2876
• RefSeq ORF: 1611
• Synonyms: b-PROTEIN; CAS2; CATB; GP75; OCA3; TRP; TRP1; TYRP
• Locus ID: 7306
• UniProt ID: P17643
• Cytogenetics: 9p23
• Summary: 'This gene encodes a melanosomal enzyme that belongs to the tyrosinase family and plays an important role in the melanin biosynthetic pathway. Defects in this gene are the cause of rufous oculocutaneous albinism and oculocutaneous albinism type III. [provided by RefSeq, Mar 2009]'
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Melanogenesis, Metabolic pathways, Tyrosine metabolism