ZNRD1 (NM_170783) Human Mass Spec Standard

CAT#: PH308651

ZNRD1 MS Standard C13 and N15-labeled recombinant protein (NP_740753)

Product Images

Coomassie blue staining of purified ZNRD1 protein (Cat# TP308651). The protein was produced from HEK293T cells transfected with ZNRD1 cDNA clone (Cat# RC208651) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208651
• Predicted MW: 13.9 kDa
• Protein Sequence:
  Sequence Link

  >RC208651 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPM
  SVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_740753
• RefSeq Size: 885
• RefSeq ORF: 378
• Synonyms: HTEX-6; HTEX6; hZR14; Rpa12; tctex-6; TCTEX6; TEX6; ZR14
• Locus ID: 30834
• UniProt ID: Q9P1U0, Q2L6J2
• Cytogenetics: 6p22.1
• Summary: This gene encodes a DNA-directed RNA polymerase I subunit. The encoded protein contains two potential zinc-binding motifs and may play a role in regulation of cell proliferation. The encoded protein may be involved in cancer and human immunodeficiency virus progression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
• Protein Families: Transcription Factors
• Protein Pathways: Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase