POLR1H (NM_170783) Human Recombinant Protein

CAT#: TP308651

Recombinant protein of human zinc ribbon domain containing 1 (ZNRD1), transcript variant a

Product Images

Coomassie blue staining of purified ZNRD1 protein (Cat# TP308651). The protein was produced from HEK293T cells transfected with ZNRD1 cDNA clone (Cat# RC208651) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208651 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPM
  SVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_740753
• Locus ID: 30834
• UniProt ID: Q9P1U0, Q2L6J2
• Cytogenetics: 6p22.1
• Refseq Size: 885
• Refseq ORF: 378
• Synonyms: A12.2; HTEX-6; HTEX6; hZR14; Rpa12; tctex-6; TCTEX6; TEX6; ZNRD1; ZR14
• Summary: This gene encodes a DNA-directed RNA polymerase I subunit. The encoded protein contains two potential zinc-binding motifs and may play a role in regulation of cell proliferation. The encoded protein may be involved in cancer and human immunodeficiency virus progression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
• Protein Families: Transcription Factors
• Protein Pathways: Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase