MTMR2 (NM_016156) Human Mass Spec Standard
CAT#: PH308703
MTMR2 MS Standard C13 and N15-labeled recombinant protein (NP_057240)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208703 |
Predicted MW | 73.4 kDa |
Protein Sequence |
>RC208703 protein sequence
Red=Cloning site Green=Tags(s) METSSSCESLGSQPAAARPPSVDSLSSASTSHSENSVHTKSASVVSSDSISTSADNFSPDLRVLRESNKL AEMEEPPLLPGENIKDMAKDVTYICPFTGAVRGTLTVTNYRLYFKSMERDPPFVLDASLGVINRVEKIGG ASSRGENSYGLETVCKDIRNLRFAHKPEGRTRRSIFENLMKYAFPVSNNLPLFAFEYKEVFPENGWKLYD PLLEYRRQGIPNESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQAT ITRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVF LDIHNIHVMRESLRKLKEIVYPNIEETHWLSNLESTHWLEHIKLILAGALRIADKVESGKTSVVVHCSDG WDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGHRFQLRVGHGDKNHADADRSPVFLQFIDCVWQM TRQFPTAFEFNEYFLITILDHLYSCLFGTFLCNSEQQRGKENLPKRTVSLWSYINSQLEDFTNPLYGSYS NHVLYPVASMRHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAELQKKVEELQREISNRSTSSSERAS SPAQCVTPVQTVV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_057240 |
RefSeq Size | 4603 |
RefSeq ORF | 1929 |
Synonyms | CMT4B; CMT4B1 |
Locus ID | 8898 |
UniProt ID | Q13614 |
Cytogenetics | 11q21 |
Summary | This gene is a member of the myotubularin family of phosphoinositide lipid phosphatases. The encoded protein possesses phosphatase activity towards phosphatidylinositol-3-phosphate and phosphatidylinositol-3,5-bisphosphate. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4B, an autosomal recessive demyelinating neuropathy. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome, Phosphatase |
Protein Pathways | Fructose and mannose metabolism, Metabolic pathways, Riboflavin metabolism, Thiamine metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404513 | MTMR2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC414151 | MTMR2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430848 | MTMR2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY404513 | Transient overexpression lysate of myotubularin related protein 2 (MTMR2), transcript variant 3 |
USD 396.00 |
|
LY414151 | Transient overexpression lysate of myotubularin related protein 2 (MTMR2), transcript variant 1 |
USD 396.00 |
|
LY430848 | Transient overexpression lysate of myotubularin related protein 2 (MTMR2), transcript variant 3 |
USD 396.00 |
|
PH314811 | MTMR2 MS Standard C13 and N15-labeled recombinant protein (NP_958438) |
USD 2,055.00 |
|
TP308703 | Recombinant protein of human myotubularin related protein 2 (MTMR2), transcript variant 1 |
USD 823.00 |
|
TP314811 | Recombinant protein of human myotubularin related protein 2 (MTMR2), transcript variant 3 |
USD 748.00 |
|
TP324099 | Recombinant protein of human myotubularin related protein 2 (MTMR2), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review