Ribonuclease T2 (RNASET2) (NM_003730) Human Mass Spec Standard

CAT#: PH308746

RNASET2 MS Standard C13 and N15-labeled recombinant protein (NP_003721)

Product Images

Coomassie blue staining of purified RNASET2 protein (Cat# TP308746). The protein was produced from HEK293T cells transfected with RNASET2 cDNA clone (Cat# RC208746) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208746
• Predicted MW: 29.5 kDa
• Protein Sequence:
  Sequence Link

  >RC208746 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRPAALRGALLGCLCLALLCLGGADKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPD
  KSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLE
  LYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQL
  QNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003721
• RefSeq Size: 1250
• RefSeq ORF: 768
• Synonyms: bA514O12.3; RNASE6PL
• Locus ID: 8635
• UniProt ID: O00584
• Cytogenetics: 6q27
• Summary: This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human malignancies and chromosomal rearrangement. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein