LYZL6 (NM_020426) Human Mass Spec Standard

CAT#: PH308863

LYZL6 MS Standard C13 and N15-labeled recombinant protein (NP_065159)

Product Images

Coomassie blue staining of purified LYZL6 protein (Cat# TP308863). The protein was produced from HEK293T cells transfected with LYZL6 cDNA clone (Cat# RC208863) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208863
• Predicted MW: 17 kDa
• Protein Sequence:
  Sequence Link

  >RC208863 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSF
  DYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFY
  WLTGCRLR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065159
• RefSeq Size: 942
• RefSeq ORF: 444
• Synonyms: HEL-S-6a; LYC1; LYZB; PRO1485; TKAL754; UNQ754
• Locus ID: 57151
• UniProt ID: O75951, A0A080YUZ6
• Cytogenetics: 17q12
• Summary: This gene encodes a member of the C-type lysozyme/alpha-lactalbumin family. C-type lysozymes are bacteriolytic factors that play a role in host defense, whereas alpha-lactalbumins mediate lactose biosynthesis. The encoded protein contains catalytic residues characteristic of C-type lysozymes and may play a role in male reproduction. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jan 2011]
• Protein Families: Secreted Protein