LYZL6 (NM_020426) Human Recombinant Protein

CAT#: TP308863

Recombinant protein of human lysozyme-like 6 (LYZL6)

Product Images

Coomassie blue staining of purified LYZL6 protein (Cat# TP308863). The protein was produced from HEK293T cells transfected with LYZL6 cDNA clone (Cat# RC208863) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208863 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSF
  DYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFY
  WLTGCRLR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_065159
• Locus ID: 57151
• UniProt ID: O75951, A0A080YUZ6
• Cytogenetics: 17q12
• Refseq Size: 942
• Refseq ORF: 444
• Synonyms: HEL-S-6a; LYC1; LYZB; PRO1485; TKAL754; UNQ754
• Summary: This gene encodes a member of the C-type lysozyme/alpha-lactalbumin family. C-type lysozymes are bacteriolytic factors that play a role in host defense, whereas alpha-lactalbumins mediate lactose biosynthesis. The encoded protein contains catalytic residues characteristic of C-type lysozymes and may play a role in male reproduction. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jan 2011]
• Protein Families: Secreted Protein