Shwachman Bodian Diamond syndrome (SBDS) (NM_016038) Human Mass Spec Standard

CAT#: PH308964

SBDS MS Standard C13 and N15-labeled recombinant protein (NP_057122)

Product Images

Coomassie blue staining of purified SBDS protein (Cat# TP308964). The protein was produced from HEK293T cells transfected with SBDS cDNA clone (Cat# RC208964) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208964
• Predicted MW: 28.8 kDa
• Protein Sequence:
  Sequence Link

  >RC208964 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKED
  LISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDI
  HYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVC
  LIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057122
• RefSeq Size: 1605
• RefSeq ORF: 750
• Synonyms: CGI-97; SDS; SWDS
• Locus ID: 51119
• UniProt ID: Q9Y3A5, A0A0S2Z5I7
• Cytogenetics: 7q11.21
• Summary: This gene encodes a highly conserved protein that plays an essential role in ribosome biogenesis. The encoded protein interacts with elongation factor-like GTPase 1 to disassociate eukaryotic initiation factor 6 from the late cytoplasmic pre-60S ribosomal subunit allowing assembly of the 80S subunit. Mutations within this gene are associated with the autosomal recessive disorder Shwachman-Bodian-Diamond syndrome. This gene has a closely linked pseudogene that is distally located. [provided by RefSeq, Jan 2017]