ICOS Ligand (ICOSLG) (NM_015259) Human Mass Spec Standard

CAT#: PH308975

ICOSLG MS Standard C13 and N15-labeled recombinant protein (NP_056074)

Product Images

Coomassie blue staining of purified ICOSLG protein (Cat# TP308975). The protein was produced from HEK293T cells transfected with ICOSLG cDNA clone (Cat# RC208975) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208975
• Predicted MW: 33.3 kDa
• Protein Sequence:
  Sequence Link

  >RC208975 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQN
  SSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSV
  PVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPS
  VNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDR
  CLQHSYAGAWAVSPETELTGHV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056074
• RefSeq Size: 3320
• RefSeq ORF: 906
• Synonyms: B7-H2; B7h; B7H2; B7RP-1; B7RP1; CD275; GL50; ICOS-L; ICOSL; LICOS
• Locus ID: 23308
• UniProt ID: O75144, A0N0L8
• Cytogenetics: 21q22.3
• Summary: Ligand for the T-cell-specific cell surface receptor ICOS. Acts as a costimulatory signal for T-cell proliferation and cytokine secretion; induces also B-cell proliferation and differentiation into plasma cells. Could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function. [UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs)