Diazepam Binding Inhibitor (DBI) (NM_020548) Human Mass Spec Standard
CAT#: PH308982
DBI MS Standard C13 and N15-labeled recombinant protein (NP_065438)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208982 |
| Predicted MW | 11.8 kDa |
| Protein Sequence |
>RC208982 protein sequence
Red=Cloning site Green=Tags(s) MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGK AKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_065438 |
| RefSeq Size | 745 |
| RefSeq ORF | 312 |
| Synonyms | ACBD1; ACBP; CCK-RP; EP |
| Locus ID | 1622 |
| UniProt ID | P07108, A0A024RAF2 |
| Cytogenetics | 2q14.2 |
| Summary | 'This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]' |
| Protein Families | Druggable Genome |
| Protein Pathways | PPAR signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412418 | DBI HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY412418 | Transient overexpression lysate of diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) (DBI), transcript variant 1 |
USD 436.00 |
|
| TP308982 | Recombinant protein of human diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) (DBI), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China