CSAG1 (NM_153478) Human Mass Spec Standard

CAT#: PH308990

CSAG1 MS Standard C13 and N15-labeled recombinant protein (NP_705611)

Product Images

Coomassie blue staining of purified CSAG1 protein (Cat# TP308990). The protein was produced from HEK293T cells transfected with CSAG1 cDNA clone (Cat# RC208990) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208990
• Predicted MW: 8.7 kDa
• Protein Sequence:
  Sequence Link

  >RC208990 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSATTACWPAFTVLGEARGDQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQPRREKGPVKE
  VPGTKGSP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_705611
• RefSeq Size: 886
• RefSeq ORF: 234
• Synonyms: CSAGE; CT24.1
• Locus ID: 158511
• UniProt ID: Q6PB30
• Cytogenetics: Xq28
• Summary: This gene encodes a member of a family of tumor antigens. The protein is expressed in chondrosarcomas, but may also be expressed in normal tissues such as testis. Alternative splicing of this gene results in two transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]