CSAG1 (NM_153478) Human Recombinant Protein

CAT#: TP308990

Purified recombinant protein of Homo sapiens chondrosarcoma associated gene 1 (CSAG1), transcript variant a

Product Images

Coomassie blue staining of purified CSAG1 protein (Cat# TP308990). The protein was produced from HEK293T cells transfected with CSAG1 cDNA clone (Cat# RC208990) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208990 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSATTACWPAFTVLGEARGDQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQPRREKGPVKE
  VPGTKGSP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 8.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_705611
• Locus ID: 158511
• UniProt ID: Q6PB30
• Cytogenetics: Xq28
• Refseq Size: 886
• Refseq ORF: 234
• Synonyms: CSAGE; CT24.1
• Summary: This gene encodes a member of a family of tumor antigens. The protein is expressed in chondrosarcomas, but may also be expressed in normal tissues such as testis. Alternative splicing of this gene results in two transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]