RBP7 (NM_052960) Human Mass Spec Standard

CAT#: PH309035

RBP7 MS Standard C13 and N15-labeled recombinant protein (NP_443192)

Product Images

Coomassie blue staining of purified RBP7 protein (Cat# TP309035). The protein was produced from HEK293T cells transfected with RBP7 cDNA clone (Cat# RC209035) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209035
• Predicted MW: 15.5 kDa
• Protein Sequence:
  Sequence Link

  >RC209035 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEE
  FDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_443192
• RefSeq Size: 704
• RefSeq ORF: 402
• Synonyms: CRABP4; CRBP4; CRBPIV
• Locus ID: 116362
• UniProt ID: Q96R05
• Cytogenetics: 1p36.22
• Summary: The protein encoded by this gene is a member of the cellular retinol-binding protein (CRBP) family, whose members are required for vitamin A stability and metabolism. The encoded protein binds all-trans-retinol and is structurally similar to other CRBPs; however, it has a lower binding affinity for retinol than other CRBPs. [provided by RefSeq, Aug 2016]