RBP7 (NM_052960) Human Mass Spec Standard
CAT#: PH309035
RBP7 MS Standard C13 and N15-labeled recombinant protein (NP_443192)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209035 |
Predicted MW | 15.5 kDa |
Protein Sequence |
>RC209035 protein sequence
Red=Cloning site Green=Tags(s) MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEE FDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_443192 |
RefSeq Size | 704 |
RefSeq ORF | 402 |
Synonyms | CRABP4; CRBP4; CRBPIV |
Locus ID | 116362 |
UniProt ID | Q96R05 |
Cytogenetics | 1p36.22 |
Summary | The protein encoded by this gene is a member of the cellular retinol-binding protein (CRBP) family, whose members are required for vitamin A stability and metabolism. The encoded protein binds all-trans-retinol and is structurally similar to other CRBPs; however, it has a lower binding affinity for retinol than other CRBPs. [provided by RefSeq, Aug 2016] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409361 | RBP7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY409361 | Transient overexpression lysate of retinol binding protein 7, cellular (RBP7) |
USD 396.00 |
|
TP309035 | Recombinant protein of human retinol binding protein 7, cellular (RBP7) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review