RBP7 (NM_052960) Human Recombinant Protein

CAT#: TP309035

Recombinant protein of human retinol binding protein 7, cellular (RBP7)

Product Images

Coomassie blue staining of purified RBP7 protein (Cat# TP309035). The protein was produced from HEK293T cells transfected with RBP7 cDNA clone (Cat# RC209035) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209035 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEE
  FDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 15.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_443192
• Locus ID: 116362
• UniProt ID: Q96R05
• Cytogenetics: 1p36.22
• Refseq Size: 704
• Refseq ORF: 402
• Synonyms: CRABP4; CRBP4; CRBPIV
• Summary: The protein encoded by this gene is a member of the cellular retinol-binding protein (CRBP) family, whose members are required for vitamin A stability and metabolism. The encoded protein binds all-trans-retinol and is structurally similar to other CRBPs; however, it has a lower binding affinity for retinol than other CRBPs. [provided by RefSeq, Aug 2016]