CDA11 (TATDN1) (NM_032026) Human Mass Spec Standard

CAT#: PH309041

TATDN1 MS Standard C13 and N15-labeled recombinant protein (NP_114415)

Product Images

Coomassie blue staining of purified TATDN1 protein (Cat# TP309041). The protein was produced from HEK293T cells transfected with TATDN1 cDNA clone (Cat# RC209041) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209041
• Predicted MW: 33.6 kDa
• Protein Sequence:
  Sequence Link

  >RC209041 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRFKFIDIGINLTDPMFRGIYRGVQKHQDDLQDVIGRAVEIGVKKFMITGGNLQDSKDALHLAQTNGMF
  FSTVGCHPTRCGEFEKNNPDLYLKELLNLAENNKGKVVAIGECGLDFDRLQFCPKDTQLKYFEKQFELSE
  QTKLPMFLHCRNSHAEFLDITKRNRDRCVGGVVHSFDGTKEAAAALIDLDLYIGFNGCSLKTEANLEVLK
  SIPSEKLMIETDAPWCGVKSTHAGSKYIRTAFPTKKKWESGHCLKDRNEPCHIIQILEIMSAVRDEDPLE
  LANTLYNNTIKVFFPGI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_114415
• RefSeq Size: 1046
• RefSeq ORF: 891
• Synonyms: CDA11
• Locus ID: 83940
• UniProt ID: Q6P1N9
• Cytogenetics: 8q24.13