CDA11 (TATDN1) (NM_032026) Human Recombinant Protein

CAT#: TP309041

Recombinant protein of human TatD DNase domain containing 1 (TATDN1)

Product Images

Coomassie blue staining of purified TATDN1 protein (Cat# TP309041). The protein was produced from HEK293T cells transfected with TATDN1 cDNA clone (Cat# RC209041) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209041 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRFKFIDIGINLTDPMFRGIYRGVQKHQDDLQDVIGRAVEIGVKKFMITGGNLQDSKDALHLAQTNGMF
  FSTVGCHPTRCGEFEKNNPDLYLKELLNLAENNKGKVVAIGECGLDFDRLQFCPKDTQLKYFEKQFELSE
  QTKLPMFLHCRNSHAEFLDITKRNRDRCVGGVVHSFDGTKEAAAALIDLDLYIGFNGCSLKTEANLEVLK
  SIPSEKLMIETDAPWCGVKSTHAGSKYIRTAFPTKKKWESGHCLKDRNEPCHIIQILEIMSAVRDEDPLE
  LANTLYNNTIKVFFPGI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_114415
• Locus ID: 83940
• UniProt ID: Q6P1N9
• Cytogenetics: 8q24.13
• Refseq Size: 1046
• Refseq ORF: 891
• Synonyms: CDA11
• Summary: Putative deoxyribonuclease.[UniProtKB/Swiss-Prot Function]