RBPJK (RBPJ) (NM_203284) Human Mass Spec Standard
CAT#: PH309094
RBPJ MS Standard C13 and N15-labeled recombinant protein (NP_976029)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209094 |
| Predicted MW | 54.4 kDa |
| Protein Sequence |
>RC209094 protein sequence
Red=Cloning site Green=Tags(s) MAWIKRKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKK EQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIG VFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHL LDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTE RMYLCLSQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNG GGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGI IYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_976029 |
| RefSeq Size | 6008 |
| RefSeq ORF | 1458 |
| Synonyms | AOS3; CBF1; csl; IGKJRB; IGKJRB1; KBF2; RBP-J; RBPJK; RBPSUH; SUH |
| Locus ID | 3516 |
| UniProt ID | Q06330 |
| Cytogenetics | 4p15.2 |
| Summary | 'The protein encoded by this gene is a transcriptional regulator important in the Notch signaling pathway. The encoded protein acts as a repressor when not bound to Notch proteins and an activator when bound to Notch proteins. It is thought to function by recruiting chromatin remodeling complexes containing histone deacetylase or histone acetylase proteins to Notch signaling pathway genes. Several transcript variants encoding different isoforms have been found for this gene, and several pseudogenes of this gene exist on chromosome 9. [provided by RefSeq, Oct 2013]' |
| Protein Families | Transcription Factors |
| Protein Pathways | Notch signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401647 | RBPJ HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC404367 | RBPJ HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC404368 | RBPJ HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC430905 | RBPJ HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401647 | Transient overexpression lysate of recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 1 |
USD 665.00 |
|
| LY404367 | Transient overexpression lysate of recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 3 |
USD 436.00 |
|
| LY404368 | Transient overexpression lysate of recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 4 |
USD 436.00 |
|
| LY430905 | Transient overexpression lysate of recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 3 |
USD 396.00 |
|
| PH304791 | RBPJ MS Standard C13 and N15-labeled recombinant protein (NP_976028) |
USD 2,055.00 |
|
| TP304791 | Recombinant protein of human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 3 |
USD 867.00 |
|
| TP309094 | Recombinant protein of human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 4 |
USD 823.00 |
|
| TP760429 | Purified recombinant protein of Human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China