HBXIP (LAMTOR5) (NM_006402) Human Mass Spec Standard

CAT#: PH309098

HBXIP MS Standard C13 and N15-labeled recombinant protein (NP_006393)

Product Images

Coomassie blue staining of purified LAMTOR5 protein (Cat# TP309098). The protein was produced from HEK293T cells transfected with LAMTOR5 cDNA clone (Cat# RC209098) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209098
• Predicted MW: 18.2 kDa
• Protein Sequence:
  Sequence Link

  >RC209098 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAV
  PLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSD
  PTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006393
• RefSeq Size: 855
• RefSeq ORF: 519
• Synonyms: HBXIP; XIP
• Locus ID: 10542
• UniProt ID: O43504, A0A0C4DGV4
• Cytogenetics: 1p13.3
• Summary: This gene encodes a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus. [provided by RefSeq, Jul 2008]