HBXIP (LAMTOR5) (NM_006402) Human Recombinant Protein
CAT#: TP309098
Recombinant protein of human hepatitis B virus x interacting protein (HBXIP)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209098 protein sequence
Red=Cloning site Green=Tags(s) MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAV PLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSD PTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006393 |
Locus ID | 10542 |
UniProt ID | O43504, A0A0C4DGV4 |
Cytogenetics | 1p13.3 |
Refseq Size | 855 |
Refseq ORF | 519 |
Synonyms | HBXIP; XIP |
Summary | This gene encodes a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401923 | LAMTOR5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401923 | Transient overexpression lysate of hepatitis B virus x interacting protein (HBXIP) |
USD 396.00 |
|
PH309098 | HBXIP MS Standard C13 and N15-labeled recombinant protein (NP_006393) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review