HBXIP (LAMTOR5) (NM_006402) Human Recombinant Protein

CAT#: TP309098

Recombinant protein of human hepatitis B virus x interacting protein (HBXIP)

Product Images

Coomassie blue staining of purified LAMTOR5 protein (Cat# TP309098). The protein was produced from HEK293T cells transfected with LAMTOR5 cDNA clone (Cat# RC209098) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209098 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAV
  PLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSD
  PTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006393
• Locus ID: 10542
• UniProt ID: O43504, A0A0C4DGV4
• Cytogenetics: 1p13.3
• Refseq Size: 855
• Refseq ORF: 519
• Synonyms: HBXIP; XIP
• Summary: This gene encodes a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus. [provided by RefSeq, Jul 2008]