CSN1 (GPS1) (NM_212492) Human Mass Spec Standard

CAT#: PH309147

GPS1 MS Standard C13 and N15-labeled recombinant protein (NP_997657)

Product Images

Coomassie blue staining of purified GPS1 protein (Cat# TP309147). The protein was produced from HEK293T cells transfected with GPS1 cDNA clone (Cat# RC209147) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209147
• Predicted MW: 59.1 kDa
• Protein Sequence:
  Sequence Link

  >RC209147 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRDSSAPSSASSSVTDLYCTPHSSRSDLVLPGTAGDFSLSASLSACTLLYEGAVEPMQIDVDPQEDPQNA
  PDVNYVVENPSLDLEQYAASYSGLMRIERLQFIADHCPTLRVEALKMALSFVQRTFNVDMYEEIHRKLSE
  ATRELQNAPDAIPESGVEPPALDTAWVEATRKKALLKLEKLDTDLKNYKGNSIKESIRRGHDDLGDHYLD
  CGDLSNALKCYSRARDYCTSAKHVINMCLNVIKVSVYLQNWSHVLSYVSKAESTPEIAEQRGERDSQTQA
  ILTKLKCAAGLAELAARKYKQAAKCLLLASFDHCDFPELLSPSNVAIYGGLCALATFDRQELQRNVISSS
  SFKLFLELEPQVRDIIFKFYESKYASCLKMLDEMKDNLLLDMYLAPHVRTLYTQIRNRALIQYFSPYVSA
  DMHRMAAAFNTTVAALEDELTQLILEGLISARVDSHSKILYARDVDQRSTTFEKSLLMGKEFQRRAKAMM
  LRAAVLRNQIHVKSPPREGSQGELTPANSQSRMSTNM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_997657
• RefSeq Size: 2363
• RefSeq ORF: 1581
• Synonyms: COPS1; CSN1; SGN1
• Locus ID: 2873
• UniProt ID: Q13098
• Cytogenetics: 17q25.3
• Summary: 'This gene is known to suppress G-protein and mitogen-activated signal transduction in mammalian cells. The encoded protein shares significant similarity with Arabidopsis FUS6, which is a regulator of light-mediated signal transduction in plant cells. [provided by RefSeq, Mar 2016]'
• Protein Families: Druggable Genome