CSN1 (GPS1) (NM_212492) Human Recombinant Protein

CAT#: TP309147

Recombinant protein of human G protein pathway suppressor 1 (GPS1), transcript variant 1

Product Images

Coomassie blue staining of purified GPS1 protein (Cat# TP309147). The protein was produced from HEK293T cells transfected with GPS1 cDNA clone (Cat# RC209147) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209147 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRDSSAPSSASSSVTDLYCTPHSSRSDLVLPGTAGDFSLSASLSACTLLYEGAVEPMQIDVDPQEDPQNA
  PDVNYVVENPSLDLEQYAASYSGLMRIERLQFIADHCPTLRVEALKMALSFVQRTFNVDMYEEIHRKLSE
  ATRELQNAPDAIPESGVEPPALDTAWVEATRKKALLKLEKLDTDLKNYKGNSIKESIRRGHDDLGDHYLD
  CGDLSNALKCYSRARDYCTSAKHVINMCLNVIKVSVYLQNWSHVLSYVSKAESTPEIAEQRGERDSQTQA
  ILTKLKCAAGLAELAARKYKQAAKCLLLASFDHCDFPELLSPSNVAIYGGLCALATFDRQELQRNVISSS
  SFKLFLELEPQVRDIIFKFYESKYASCLKMLDEMKDNLLLDMYLAPHVRTLYTQIRNRALIQYFSPYVSA
  DMHRMAAAFNTTVAALEDELTQLILEGLISARVDSHSKILYARDVDQRSTTFEKSLLMGKEFQRRAKAMM
  LRAAVLRNQIHVKSPPREGSQGELTPANSQSRMSTNM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 58.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_997657
• Locus ID: 2873
• UniProt ID: Q13098
• Cytogenetics: 17q25.3
• Refseq Size: 2363
• Refseq ORF: 1581
• Synonyms: COPS1; CSN1; SGN1
• Summary: This gene is known to suppress G-protein and mitogen-activated signal transduction in mammalian cells. The encoded protein shares significant similarity with Arabidopsis FUS6, which is a regulator of light-mediated signal transduction in plant cells. [provided by RefSeq, Mar 2016]
• Protein Families: Druggable Genome