ZADH1 (PTGR2) (NM_152444) Human Mass Spec Standard

CAT#: PH309182

PTGR2 MS Standard C13 and N15-labeled recombinant protein (NP_689657)

Product Images

Coomassie blue staining of purified PTGR2 protein (Cat# TP309182). The protein was produced from HEK293T cells transfected with PTGR2 cDNA clone (Cat# RC209182) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209182
• Predicted MW: 38.5 kDa
• Protein Sequence:
  Sequence Link

  >RC209182 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MIVQRVVLNSRPGKNGNPVAENFRMEEVYLPDNINEGQVQVRTLYLSVDPYMRCRMNEDTGTDYITPWQL
  SQVVDGGGIGIIEESKHTNLTKGDFVTSFYWPWQTKVILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTS
  LIGIQEKGHITAGSNKTMVVSGAAGACGSVAGQIGHFLGCSRVVGICGTHEKCILLTSELGFDAAINYKK
  DNVAEQLRESCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVPYPPPLSPAIEAIQKER
  NITRERFLVLNYKDKFEPGILQLSQWFKEGKLKIKETVINGLENMGAAFQSMMTGGNIGKQIVCISEEIS
  L
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689657
• RefSeq Size: 2610
• RefSeq ORF: 1053
• Synonyms: HEL-S-298; PGR2; ZADH1
• Locus ID: 145482
• UniProt ID: Q8N8N7, V9HW32
• Cytogenetics: 14q24.3
• Summary: This gene encodes an enzyme involved in the metabolism of prostaglandins. The encoded protein catalyzes the NADPH-dependent conversion of 15-keto-prostaglandin E2 to 15-keto-13,14-dihydro-prostaglandin E2. This protein may also be involved in regulating activation of the peroxisome proliferator-activated receptor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]
• Protein Families: Druggable Genome