GNAQ (NM_002072) Human Mass Spec Standard
CAT#: PH309199
GNAQ MS Standard C13 and N15-labeled recombinant protein (NP_002063)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC209199 |
Predicted MW | 42.1 kDa |
Protein Sequence |
>RC209199 protein sequence
Red=Cloning site Green=Tags(s) MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDE DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPG IQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQR SERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLE EKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ LNLKEYNLV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002063 |
RefSeq Size | 6343 |
RefSeq ORF | 1077 |
Synonyms | CMC1; G-ALPHA-q; GAQ; SWS |
Locus ID | 2776 |
UniProt ID | P50148, A0A024R240 |
Cytogenetics | 9q21.2 |
Summary | 'This locus encodes a guanine nucleotide-binding protein. The encoded protein, an alpha subunit in the Gq class, couples a seven-transmembrane domain receptor to activation of phospolipase C-beta. Mutations at this locus have been associated with problems in platelet activation and aggregation. A related pseudogene exists on chromosome 2.[provided by RefSeq, Nov 2010]' |
Protein Families | Druggable Genome |
Protein Pathways | Alzheimer's disease, Calcium signaling pathway, Gap junction, GnRH signaling pathway, Huntington's disease, Long-term depression, Long-term potentiation, Melanogenesis, Vascular smooth muscle contraction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400763 | GNAQ HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400763 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), q polypeptide (GNAQ) |
USD 325.00 |
|
TP309199 | Recombinant protein of human guanine nucleotide binding protein (G protein), q polypeptide (GNAQ) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review