GNAQ (NM_002072) Human Mass Spec Standard

CAT#: PH309199

GNAQ MS Standard C13 and N15-labeled recombinant protein (NP_002063)

Product Images

Coomassie blue staining of purified GNAQ protein (Cat# TP309199). The protein was produced from HEK293T cells transfected with GNAQ cDNA clone (Cat# RC209199) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209199
• Predicted MW: 42.1 kDa
• Protein Sequence:
  Sequence Link

  >RC209199 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDE
  DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPG
  IQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQR
  SERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLE
  EKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ
  LNLKEYNLV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002063
• RefSeq Size: 6343
• RefSeq ORF: 1077
• Synonyms: CMC1; G-ALPHA-q; GAQ; SWS
• Locus ID: 2776
• UniProt ID: P50148, A0A024R240
• Cytogenetics: 9q21.2
• Summary: 'This locus encodes a guanine nucleotide-binding protein. The encoded protein, an alpha subunit in the Gq class, couples a seven-transmembrane domain receptor to activation of phospolipase C-beta. Mutations at this locus have been associated with problems in platelet activation and aggregation. A related pseudogene exists on chromosome 2.[provided by RefSeq, Nov 2010]'
• Protein Families: Druggable Genome
• Protein Pathways: Alzheimer's disease, Calcium signaling pathway, Gap junction, GnRH signaling pathway, Huntington's disease, Long-term depression, Long-term potentiation, Melanogenesis, Vascular smooth muscle contraction