Leptin (LEP) (NM_000230) Human Mass Spec Standard

CAT#: PH309259

LEP MS Standard C13 and N15-labeled recombinant protein (NP_000221)

Product Images

Coomassie blue staining of purified LEP protein (Cat# TP309259). The protein was produced from HEK293T cells transfected with LEP cDNA clone (Cat# RC209259) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209259
• Predicted MW: 18.6 kDa
• Protein Sequence:
  Sequence Link

  >RC209259 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPIL
  TLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGY
  STEVVALSRLQGSLQDMLWQLDLSPGC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000221
• RefSeq Size: 3444
• RefSeq ORF: 501
• Synonyms: LEPD; OB; OBS
• Locus ID: 3952
• UniProt ID: P41159, A4D0Y8
• Cytogenetics: 7q32.1
• Summary: 'This gene encodes a protein that is secreted by white adipocytes into the circulation and plays a major role in the regulation of energy homeostasis. Circulating leptin binds to the leptin receptor in the brain, which activates downstream signaling pathways that inhibit feeding and promote energy expenditure. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis, reproduction, bone formation and wound healing. Mutations in this gene and its regulatory regions cause severe obesity and morbid obesity with hypogonadism in human patients. A mutation in this gene has also been linked to type 2 diabetes mellitus development. [provided by RefSeq, Aug 2017]'
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Adipocytokine signaling pathway, Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, Neuroactive ligand-receptor interaction