Leptin (LEP) (NM_000230) Human Recombinant Protein
CAT#: TP723267
Purified recombinant protein of Human leptin (LEP).
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
|
Tag | Tag Free |
Predicted MW | 16 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | PeproTech's human Leptin is biologically active in the ob/ob mouse obesity model. The ob/ob mice were treated via intraperitoneal injection once daily at a dose of 5 ug Leptin/gm of body weight for 7 days. Significant effects on body weight, food consumption, and plasma glucose levels were observed to saline-treated controls. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000221 |
Locus ID | 3952 |
UniProt ID | P41159, A4D0Y8 |
Cytogenetics | 7q32.1 |
Refseq Size | 3444 |
Refseq ORF | 501 |
Synonyms | LEPD; OB; OBS |
Summary | 'This gene encodes a protein that is secreted by white adipocytes into the circulation and plays a major role in the regulation of energy homeostasis. Circulating leptin binds to the leptin receptor in the brain, which activates downstream signaling pathways that inhibit feeding and promote energy expenditure. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis, reproduction, bone formation and wound healing. Mutations in this gene and its regulatory regions cause severe obesity and morbid obesity with hypogonadism in human patients. A mutation in this gene has also been linked to type 2 diabetes mellitus development. [provided by RefSeq, Aug 2017]' |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Adipocytokine signaling pathway, Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, Neuroactive ligand-receptor interaction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400087 | LEP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400087 | Transient overexpression lysate of leptin (LEP) |
USD 325.00 |
|
PH309259 | LEP MS Standard C13 and N15-labeled recombinant protein (NP_000221) |
USD 2,055.00 |
|
TP309259 | Recombinant protein of human leptin (LEP) |
USD 823.00 |
|
TP720054 | Recombinant protein of human leptin (LEP) |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review