FOXN2 (NM_002158) Human Mass Spec Standard

CAT#: PH309269

FOXN2 MS Standard C13 and N15-labeled recombinant protein (NP_002149)

Product Images

Coomassie blue staining of purified FOXN2 protein (Cat# TP309269). The protein was produced from HEK293T cells transfected with FOXN2 cDNA clone (Cat# RC209269) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209269
• Predicted MW: 47.2 kDa
• Protein Sequence:
  Sequence Link

  >RC209269 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGPVIGMTPDKRAETPGAEKIAGLSQIYKMGSLPEAVDAARPKATLVDSESADDELTNLNWLHESTNLLT
  NFSLGSEGLPIVSPLYDIEGDDVPSFGPACYQNPEKKSATSKPPYSFSLLIYMAIEHSPNKCLPVKEIYS
  WILDHFPYFATAPTGWKNSVRHNLSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLIQALKKQPFSSAS
  SQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHH
  PSAVRLQESDSLATSIDPKEDHNYSASSMAAQRCASRSSVSSLSSVDEVYEFIPKNSHVGSDGSEGFHSE
  EDTDVDYEDDPLGDSGYASQPCAKISEKGQSGKKMRKQTCQEIDEELKEAAGSLLHLAGIRTCLGSLIST
  AKTQNQKQRKK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002149
• RefSeq Size: 5472
• RefSeq ORF: 1293
• Synonyms: HTLF
• Locus ID: 3344
• UniProt ID: P32314
• Cytogenetics: 2p16.3
• Summary: This gene encodes a forkhead domain binding protein and may function in the transcriptional regulation of the human T-cell leukemia virus long terminal repeat. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors