Germany
Japan
United Kingdom
China
FOXN2 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human FOXN2 / HTLF |
Antibodies
View as table Download
Rabbit polyclonal anti-FOXN2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human FOXN2. |
Rabbit polyclonal anti-Foxn2 antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for anti-Foxn2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MGPVIGMTPDKRAETPGAEKVAGLSQIYKMGSLPEAGDAARPKATLVGSE |
Rabbit polyclonal anti-Foxn2 antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for anti-Foxn2 antibody: synthetic peptide directed towards the n terminal of mouse Foxn2. Synthetic peptide located within the following region: KRAETPGAEKVAGLSQIYKMGSLPEAGDAARPKATLVGSESADDELTNLN |
Rabbit Polyclonal Anti-HTLF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HTLF Antibody: synthetic peptide directed towards the N terminal of human HTLF. Synthetic peptide located within the following region: KRAETPGAEKIAGLSQIYKMGSLPEAVDAARPKATLVDSESADDELTNLN |
Rabbit Polyclonal Anti-HTLF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HTLF Antibody: synthetic peptide directed towards the C terminal of human HTLF. Synthetic peptide located within the following region: GKKMRKQTCQEIDEELKEAAGSLLHLAGIRTCLGSLISTAKTQNQKQRKK |
Carrier-free (BSA/glycerol-free) FOXN2 mouse monoclonal antibody,clone OTI5H8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FOXN2 mouse monoclonal antibody,clone OTI7D12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FOXN2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FOXN2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 172-431 of human FOXN2 (NP_002149.2). |
| Modifications | Unmodified |
FOXN2 mouse monoclonal antibody,clone OTI5H8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
FOXN2 mouse monoclonal antibody,clone OTI5H8, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
FOXN2 mouse monoclonal antibody,clone OTI5H8, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
FOXN2 mouse monoclonal antibody,clone OTI5H8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FOXN2 mouse monoclonal antibody,clone OTI7D12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
FOXN2 mouse monoclonal antibody,clone OTI7D12, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
FOXN2 mouse monoclonal antibody,clone OTI7D12, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
FOXN2 mouse monoclonal antibody,clone OTI7D12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- FOXN2