FOXN2 Rabbit Polyclonal Antibody

CAT#: TA335849

Rabbit Polyclonal Anti-HTLF Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "FOXN2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-HTLF Antibody: synthetic peptide directed towards the N terminal of human HTLF. Synthetic peptide located within the following region: KRAETPGAEKIAGLSQIYKMGSLPEAVDAARPKATLVDSESADDELTNLN
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 47 kDa
Gene Name forkhead box N2
Background Human T-cell leukemia virus enhancer factor (HTLF) may be a forkhead domain binding protein. It may function in the transcriptional regulation of the human T-cell leukemia virus long terminal repeat.Human T-cell leukemia virus enhancer factor (HTLF) may be a forkhead domain binding protein. It may function in the transcriptional regulation of the human T-cell leukemia virus long terminal repeat.
Synonyms HTLF
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Rat: 86%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.