FOXN2 Rabbit Polyclonal Antibody

CAT#: TA335849

Rabbit Polyclonal Anti-HTLF Antibody

Product Images

WB Suggested Anti-HTLF Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HTLF Antibody: synthetic peptide directed towards the N terminal of human HTLF. Synthetic peptide located within the following region: KRAETPGAEKIAGLSQIYKMGSLPEAVDAARPKATLVDSESADDELTNLN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: forkhead box N2
• Database Link:
  NP_002149
  Entrez Gene 3344 Human
  UniProt ID P32314
• Background: Human T-cell leukemia virus enhancer factor (HTLF) may be a forkhead domain binding protein. It may function in the transcriptional regulation of the human T-cell leukemia virus long terminal repeat.Human T-cell leukemia virus enhancer factor (HTLF) may be a forkhead domain binding protein. It may function in the transcriptional regulation of the human T-cell leukemia virus long terminal repeat.
• Synonyms: HTLF
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Rat: 86%

Reference Data

• Protein Families: Transcription Factors