PIGL (NM_004278) Human Mass Spec Standard

CAT#: PH309339

PIGL MS Standard C13 and N15-labeled recombinant protein (NP_004269)

Product Images

Coomassie blue staining of purified PIGL protein (Cat# TP309339). The protein was produced from HEK293T cells transfected with PIGL cDNA clone (Cat# RC209339) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209339
• Predicted MW: 28.5 kDa
• Protein Sequence:
  Sequence Link

  >RC209339 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHPDDEAMFFAPTVLGLARLRHW
  VYLLCFSAGNYYNQGETRKKELLQSCDVLGIPLSSVMIIDNRDFPDDPGMQWDTEHVARVLLQHIEVNGI
  NLVVTFDAGGVSGHSNHIALYAAVRALHSEGKLPKGCSVLTLQSVNVLRKYISLLDLPLSLLHTQDVLFV
  LNSKEVAQAKKAMSCHRSQLLWFRRLYIIFSRYMRINSLSFL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004269
• RefSeq Size: 1163
• RefSeq ORF: 756
• Synonyms: CHIME
• Locus ID: 9487
• UniProt ID: Q9Y2B2
• Cytogenetics: 17p11.2
• Summary: This gene encodes an enzyme that catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis, which is the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI). Study of a similar rat enzyme suggests that this protein localizes to the endoplasmic reticulum. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane
• Protein Pathways: Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways