PIGL (NM_004278) Human Recombinant Protein

CAT#: TP309339

Recombinant protein of human phosphatidylinositol glycan anchor biosynthesis, class L (PIGL)

Product Images

Coomassie blue staining of purified PIGL protein (Cat# TP309339). The protein was produced from HEK293T cells transfected with PIGL cDNA clone (Cat# RC209339) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209339 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHPDDEAMFFAPTVLGLARLRHW
  VYLLCFSAGNYYNQGETRKKELLQSCDVLGIPLSSVMIIDNRDFPDDPGMQWDTEHVARVLLQHIEVNGI
  NLVVTFDAGGVSGHSNHIALYAAVRALHSEGKLPKGCSVLTLQSVNVLRKYISLLDLPLSLLHTQDVLFV
  LNSKEVAQAKKAMSCHRSQLLWFRRLYIIFSRYMRINSLSFL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004269
• Locus ID: 9487
• UniProt ID: Q9Y2B2
• Cytogenetics: 17p11.2
• Refseq Size: 1163
• Refseq ORF: 756
• Synonyms: CHIME
• Summary: This gene encodes an enzyme that catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis, which is the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI). Study of a similar rat enzyme suggests that this protein localizes to the endoplasmic reticulum. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane
• Protein Pathways: Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways