SCP3 (SYCP3) (NM_153694) Human Mass Spec Standard

CAT#: PH309340

SYCP3 MS Standard C13 and N15-labeled recombinant protein (NP_710161)

Product Images

Coomassie blue staining of purified SYCP3 protein (Cat# TP309340). The protein was produced from HEK293T cells transfected with SYCP3 cDNA clone (Cat# RC209340) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209340
• Predicted MW: 27.7 kDa
• Protein Sequence:
  Sequence Link

  >RC209340 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEV
  QNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDM
  QKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAM
  LQKKIMMETQQQEIASVRKSLQSMLF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_710161
• RefSeq Size: 1137
• RefSeq ORF: 708
• Synonyms: COR1; RPRGL4; SCP3; SPGF4
• Locus ID: 50511
• UniProt ID: Q8IZU3, A0A024RBF8
• Cytogenetics: 12q23.2
• Summary: This gene encodes an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. Mutations in this gene are associated with azoospermia in males and susceptibility to pregnancy loss in females. Alternate splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, May 2010]