SCP3 (SYCP3) (NM_153694) Human Recombinant Protein

CAT#: TP309340

Recombinant protein of human synaptonemal complex protein 3 (SYCP3)

Product Images

Coomassie blue staining of purified SYCP3 protein (Cat# TP309340). The protein was produced from HEK293T cells transfected with SYCP3 cDNA clone (Cat# RC209340) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209340 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVSSGKKYSRKSGKPSVEDQFTRAYDFETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEV
  QNMLEGVGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYSQQFLTLFQQWDLDM
  QKAEEQEEKILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAM
  LQKKIMMETQQQEIASVRKSLQSMLF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_710161
• Locus ID: 50511
• UniProt ID: Q8IZU3, A0A024RBF8
• Cytogenetics: 12q23.2
• Refseq Size: 1137
• Refseq ORF: 708
• Synonyms: COR1; RPRGL4; SCP3; SPGF4
• Summary: This gene encodes an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. Mutations in this gene are associated with azoospermia in males and susceptibility to pregnancy loss in females. Alternate splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, May 2010]